Thursday, 20 Nov 2025
  • Contact
  • Privacy Policy
  • Terms & Conditions
  • DMCA
logo logo
  • World
  • Politics
  • Crime
  • Economy
  • Tech & Science
  • Sports
  • Entertainment
  • More
    • Education
    • Celebrities
    • Culture and Arts
    • Environment
    • Health and Wellness
    • Lifestyle
  • 🔥
  • Trump
  • VIDEO
  • House
  • White
  • ScienceAlert
  • Trumps
  • Watch
  • man
  • Health
  • Season
Font ResizerAa
American FocusAmerican Focus
Search
  • World
  • Politics
  • Crime
  • Economy
  • Tech & Science
  • Sports
  • Entertainment
  • More
    • Education
    • Celebrities
    • Culture and Arts
    • Environment
    • Health and Wellness
    • Lifestyle
Follow US
© 2024 americanfocus.online – All Rights Reserved.
American Focus > Blog > Tech and Science > Are you the friend that’s always misplacing your wallet? You need this tracking card
Tech and Science

Are you the friend that’s always misplacing your wallet? You need this tracking card

Last updated: October 13, 2024 12:40 pm
Share
Are you the friend that’s always misplacing your wallet? You need this tracking card
SHARE

If you’re someone who frequently misplaces your belongings like your wallet or keys, you’re not alone. Studies show that 62 percent of Americans have lost or misplaced their wallets at some point. But now, there’s a solution to help you keep track of your items – the KeySmart SmartCard.

The KeySmart SmartCard is a game-changer when it comes to finding your lost items. This innovative tracking card works similarly to Apple’s AirTags but comes in a sleek, credit card-sized design that fits easily in your wallet or pocket. With this three-pack available for $89.99 (originally $119) with free shipping, you can ensure that you never lose track of your essentials again.

One of the main advantages of the KeySmart SmartCard is its wireless charging capability. Just like AirTags, you can use your iPhone to make your items ring loudly, helping you locate them quickly. Whether you’re at home, in the car, or out and about, you can easily track down your misplaced belongings with this handy device.

In addition to helping you find lost items, the KeySmart SmartCard also notifies you if you leave something behind. Whether it’s your keys, wallet, or another essential item, you’ll receive alerts on your iPhone, CarPlay, or AirPods to remind you to grab your belongings before you leave them behind.

If you do happen to lose your keys or wallet, you can use the Find My app to track them in Lost Mode. This feature allows you to see the last known location of your items on a map and display a message with contact information for whoever finds them. This increases the chances of having your lost items returned to you.

See also  Scale AI confirms 'significant' investment from Meta, says CEO Alexanr Wang is leaving

Don’t wait until you lose something important to invest in the KeySmart SmartCard. Take advantage of the three-pack offer for $89.99 with free shipping and enjoy the peace of mind that comes with knowing you can easily track and locate your belongings wherever you go. Visit the official website to purchase your KeySmart SmartCard today.

TAGGED:cardfriendmisplacingtrackingwallet
Share This Article
Twitter Email Copy Link Print
Previous Article ‘Saturday Night Live’ Technical Issue Before Stevie Nicks’ Performance Paused the Show ‘Saturday Night Live’ Technical Issue Before Stevie Nicks’ Performance Paused the Show
Next Article Is AI Dumber than a Cat? Some Related Points Is AI Dumber than a Cat? Some Related Points
Leave a comment

Leave a Reply Cancel reply

Your email address will not be published. Required fields are marked *

Popular Posts

On The Big And Small Screens

Flying High! Exploring the Legacy of Superman Actors Published July 13, 2025 4:00 PM PDT…

July 13, 2025

Applications open for CNBC’s top global fintechs list

CNBC has once again partnered with market research firm Statista to compile a list of…

February 25, 2025

Yankees-Dodgers World Series Game 1 Grabs Biggest Audience Since 2017

The 2025 World Series got off to an exciting start on Friday as the Los…

October 26, 2024

Italian Teacher At Catholic School Caught Moonlighting On OnlyFans, Suspended

A 29-year-old teacher at a Catholic school in Italy has been suspended after it was…

March 21, 2025

NYC straphangers cheer Hochul vow to put cops on overnight subways — but plan remains unclear

Stephen Yang Despite the skepticism from some within the NYPD, Hochul's plan to increase police…

January 16, 2025

You Might Also Like

Spotify’s latest feature lets you transfer playlists from other services
Tech and Science

Spotify’s latest feature lets you transfer playlists from other services

November 20, 2025
How Much Protein Do You Need? Experts Explain
Tech and Science

How Much Protein Do You Need? Experts Explain

November 20, 2025
Samsung Galaxy A36 Black Friday Deal Saves You £150
Tech and Science

Samsung Galaxy A36 Black Friday Deal Saves You £150

November 20, 2025
Climate heating has reached even deepest parts of the Arctic Ocean
Tech and Science

Climate heating has reached even deepest parts of the Arctic Ocean

November 20, 2025
logo logo
Facebook Twitter Youtube

About US


Explore global affairs, political insights, and linguistic origins. Stay informed with our comprehensive coverage of world news, politics, and Lifestyle.

Top Categories
  • Crime
  • Environment
  • Sports
  • Tech and Science
Usefull Links
  • Contact
  • Privacy Policy
  • Terms & Conditions
  • DMCA

© 2024 americanfocus.online –  All Rights Reserved.

Welcome Back!

Sign in to your account

Lost your password?